PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000668138
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 1711aa    MW: 186198 Da    PI: 6.1067
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000668138genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.31.1e-10794837247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++WT+eE el+++  + +G++ +++I++ +  ++t  +c+++++k+
    MDP0000668138 794 NPWTPEEKELFIQKLTTYGKD-FRKISSFLD-HKTTADCVEFYYKH 837
                      69*****************99.*********.************97 PP

2Myb_DNA-binding31.73.7e-1010131053345
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45  
                        WT eE  ++++av  +G++ ++ I+r++   R+  qck ++ 
    MDP0000668138 1013 DWTDEEKSRFIQAVSSYGKD-FAMISRCIR-SRSQHQCKVFFS 1053
                       6*****************99.*********.********8776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.88E-15779839IPR009057Homeodomain-like
PROSITE profilePS5129317.028791842IPR017884SANT domain
SMARTSM007176.4E-11792840IPR001005SANT/Myb domain
PfamPF002498.6E-8794837IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-7795839IPR009057Homeodomain-like
PROSITE profilePS5129311.28810091060IPR017884SANT domain
SMARTSM007171.9E-710101058IPR001005SANT/Myb domain
SuperFamilySSF466893.35E-1010111060IPR009057Homeodomain-like
PfamPF002492.5E-710131053IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-610131054IPR009057Homeodomain-like
CDDcd001673.55E-610141052No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1711 aa     Download sequence    Send to blast
MPPEPLPWDR KDFFKERKHE RSESLGSVAR WRDSPHHAPR DFNRWASGDF RRPPGHGKQG  60
GWHVFSDDSG HGYGSSRSGD KMVEDESFRP SFSRGDGRYG RNSRDNRGPP YSQRESKGYS  120
WETRSGSPNM PGRPNRVNNE QRSQDDMLTY SSHQQSDFGS TWDQIQLKDQ LDKMGGSTGL  180
GSGQKCEREN SLVSIDWKPL KWTRSGSMSS RGSGFSHSSS SKSMGPIDSN EAKVESQPKT  240
ATPVQSPSGE ATNCVTSAAP LEETTSRKKP RLGWGEGLAK YEKKKVDVPD GSMNKDAAVC  300
SVGNTEPAHS LSSSLPDKSP RVTVFSDCAS PATPSSVACS SSPVHVVTGV EEKSFCKAVN  360
VENDTRNFCG SPGPMSQIHH EGFSFQLEKL DGNSLVNXDS SILELLQSDD PSSVDSSIXR  420
PTALNKLLIW KGEISKVLEV TESEIDSLEN ELKALKSDSG GSXPHPATSS SLPVEEKDKS  480
CKEQVTNLIT WPSPLQIHSS GDTNVQKMCV DNGDQXEFCG IVKDEDIDSP GTATSKFVES  540
LPLVSSDMTN KTGGSEDRDP IQTTKGEEXC LVPSRYAEKT DPSTCGNSSM LLDSEVVAPD  600
SGVVVDKLCD SIFSANKIFA SRASDIFSKL LXKEHISGVS VSSSWKNDSL IKEKFAKRKR  660
XLRFMERVIT LKFKAFQHLW KEDMSVLSMR KYRSKSHKKF ELSLRATNNG HQKHRSSIRS  720
RFSTPGSLSL VPTTEIINFT NKLLSDSQVK PYRNSLKMPA LILDKEEKLA TRFVSSNGLV  780
EDPCAVEKER ALMNPWTPEE KELFIQKLTT YGKDFRKISS FLDHKTTADC VEFYYKHHKS  840
DCFVKTKKKP DMAKQGKSSA NTYLISDGKK WNREMDAASL DILGAASAIA AHADGGTRNR  900
QTYSRRLILG XYRNTNTSRS EDTTVERSCS LDTIGNERET AAADVLAGIC GSMSSEAVSS  960
CITSSIDPGE SYLEWKCQKG DSVVRXPLTP DVMQNVDDET CSDESCGEMD PSDWTDEEKS  1020
RFIQAVSSYG KDFAMISRCI RSRSQHQCKV FFSKARKCLG LDFVHPGPGN GTSVGDDANG  1080
GGSDTEDACV LETGSGISSD KSGCNMNEDV PPSVTNMNAD EADPAETMKL QTSPPRPEEN  1140
NVMGEVDHGD GKPLKSLASD AFQXVDKPKL VFDGDTDIMD FDAMGGNATE NKILVAESRP  1200
VGEGINSDPP NPECMVGEKL VGQISSDRFG KKLEGSDERS NRDPSGCCLP ASAHNSCGNT  1260
SDVAADGSCS GPGLNPECPC QVSVELNSVQ NPSVISLTHE NAPATAVSVP QDSAVIECEK  1320
SLSQDRLSST LDLREGSVGR DESXKHLSGL LGHANVEPLQ VLRGYPLQMV PKKETNGDVS  1380
CGNLSEVKPD RNINGHYMTQ DDFLQFGNSK PQCSRVDCPP LPLKVEKPGD ARKAHSWSST  1440
DSDKPSRNGD VKLFGKILSN PSSLSXSNGS IHENEEEGAH NQKLSSKSSN LNLTGHHSAD  1500
GNSPLLKFDC SSYLGLENVP SRSYGGFWEG NKVQAGNSSF XDSAILLAKY PAAFSNFPTS  1560
SSQMEQQPLQ AVVKTNDRSM NGISVFRGEE INGSNGVADY PVFSRGQDGG NKVQPFTVDV  1620
KQQQRQDVLD IPRRNGFDAI SSIQQQGRGS VGMNVVGRGG ILVGGPCTVV SDPVAAIRMH  1680
YAKTEQYGGX AGSIFRKEES WRGGKGDIGR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C4e-15758843993NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D4e-15758843993NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008381970.10.0PREDICTED: uncharacterized protein LOC103444807 isoform X2
TrEMBLM5XR660.0M5XR66_PRUPE; Uncharacterized protein
STRINGVIT_13s0019g04010.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49863352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.10.0MYB family protein